Website stats for Lcwaikiki - lcwaikiki.ma
En continuant utiliser le site Web de LC WAIKIKI, vous acceptez nos politiques de cookies
It has a alexa rank of #121,826 in the world. It is a domain having .ma extension. It is estimated worth of $ 102,600.00 and have a daily income of around $ 171.00. As no active threats were reported recently, lcwaikiki.ma is SAFE to browse.
Traffic Report
| Daily Unique Visitors: | 13,674 |
| Daily Pageviews: | 68,370 |
Estimated Valuation
| Income Per Day: | $ 171.00 |
| Estimated Worth: | $ 102,600.00 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: |
 Very Poor
|
| WOT Privacy: |
Very Poor
|
| WOT Child Safety: |
Very Poor
|
Website Ranks & Scores
| Alexa Rank: | 121,826 |
| PageSpeed Score: | 33 ON 100 |
| Domain Authority: |
49 ON 100 
|
| Bounce Rate: | Not Applicable |
| Time On Site: | Not Applicable |
Web Server Information
Hosted IP Address:
52.29.73.247
Hosted Country:
DE
Location Latitude:
50.1109Location Longitude:
8.682Traffic Classification
| Total Traffic: | No Data |
| Direct Traffic: | No Data |
| Referral Traffic: | No Data |
| Search Traffic: | No Data |
| Social Traffic: | No Data |
| Mail Traffic: | No Data |
| Display Traffic: | No Data |
Search Engine Results For lcwaikiki.ma
LC Waikiki Maroc - LCW Morocco
LC Waikiki Morocco is now open! Click here to start online shopping with LCW Maroc!
LCW Online Alışveriş Sitesi | Önümde Hayat Üstümde LC ...
We would like to show you a description here but the site won’t allow us.
30% Off Lcwaikiki Black Friday Ads, Coupons & Promo Codes 2020
Great chance to save money at lcwaikiki.com because Black Friday 2020 are here now! Enjoy ????30% Off store discounts and find the latest and greatest Lcwaikiki ads, deals and...
LC Waikiki - Home | Facebook
L'ambiance festive est arrivée! Visitez les magasins LC WAIKIKI et www.lcwaikiki.ma pour des cadeaux et de nouveaux vêtements pour vos êtres les plus chers.
LC WAIKIKI المغرب (@lcwaikiki.morocco) • Instagram ...
- https://www.instagram.com/lcwaikiki.morocco/
374.4k Followers, 35 Following, 1,375 Posts - See Instagram photos and videos from LC WAIKIKI المغرب (@lcwaikiki.morocco)
LC Waikiki - Offre spéciale! Visitez lcwaikiki.ma et ...
Offre spéciale! Visitez lcwaikiki.ma et obtenez jusqu'à 70% de réduction sur les nouveaux articles de la saison! 李 عرض خاص! قم بزيارة lcwaikiki.ma واحصل على قطع الموسم الجديدة...
Lcwaikiki.ma : LC Waikiki Maroc - LCW Morocco - HypeStat
• Lcwaikiki.ma receives approximately 6.1K visitors and 43,979 page impressions per day.
lcwaikiki.ma Free Email Domain Validation | MailboxValidator
Free lcwaikiki.ma email domain validation to check mail server and email policy. Sign up free trial license for 100 queries.
LC WAIKIKI - CITYMALL Lebanon
May 17, 2017 · LC Waikiki embodies the philosophy that everyone deserves to dress well regardless of their age, weight, and financial status. This is why we focus on providing...
LC WAIKIKI - Welcome to South Africa | Retail Advice
LC Waikiki On the 8th December 2018 LC Waikiki opened a store in Tygervalley mall Capetown. The store offers a range of Ladies, Men’s, Kids and infants fashion merchandise at...
مشترياتي : ملابس بأثمنة مناسبة جدآآ بالأنترنيت !! - YouTube
May 27, 2019 · موقع : https://www.lcwaikiki.ma سروال : https://www.lcwaikiki.ma/c/women/jeans/?sorter=price&page=1 قميص : https://www.lcwaikiki.ma/p/t-shirt-9sp514z8 ...
LC Waikiki Romania - Haine Online - Moda 2020 - LCW RO
LC Waikiki Romania – Magazin Online Oficial. Imbracaminte pentru toata familia la cele mai bune preturi. Comanda Haine Online! Livrare & Retur Gratuit!
rabat agdal morocco - YouTube
Dec 12, 2012 · Víkingur Ólafsson – Bach: Aria variata (alla maniera italiana) in A Minor, BWV 989 | Yellow Lounge - Duration: 15:25. Yellow Lounge Recommended for you
lcwaikiki.ma Competitive Analysis, Marketing Mix and ...
lcwaikiki.ma Competitive Analysis, Marketing Mix and Traffic . Welcome to Alexa's Site Overview. Enter a site above to get started. ...
Waikiki Coupons w/ September 2020 at Dealscove
Aug 11, 2020 · Total 4 active waikiki.com Promotion Codes & Deals are listed and the latest one is updated on August 11, 2020; 0 coupons and 4 deals which offer up to extra...
B U N N Y M A K E U P’s Instagram photo: “ Ma van a ...
- https://www.instagram.com/p/B9bsSajn1uP/
92 Likes, 0 Comments - B U N N Y M A K E U P (@nyul_alexandra) on Instagram: “ Ma van a @lcwaikiki.hungary üzlet megnyitója!???? 20% kedvezmeny minden termékre! ????#lcwaikiki…”
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
| H3 Headings: | 7 | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | 25 |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Two Phrase Analysis
| Words | Occurrences | Density | Possible Spam |
|---|---|---|---|
| name creative | 14 | 3.794 % | No |
| creative position | 14 | 3.794 % | No |
| position 1 | 9 | 2.439 % | No |
| partir de | 3 | 0.813 % | No |
| 1 id | 3 | 0.813 % | No |
| Femme Homme | 3 | 0.813 % | No |
| Politique de | 2 | 0.542 % | No |
| EN العربية | 2 | 0.542 % | No |
| A partir | 2 | 0.542 % | No |
| id name | 2 | 0.542 % | No |
| id httpswwwlcwaikikimaencwomentunics | 2 | 0.542 % | No |
| العربية FR | 2 | 0.542 % | No |
| id httpswwwlcwaikikimaenkidshappydreamspyjamas | 2 | 0.542 % | No |
| httpswwwlcwaikikimaencwomentunics name | 2 | 0.542 % | No |
| id httpswwwlcwaikikimaenkidsjeansweatshirt | 2 | 0.542 % | No |
| Découvrez id | 2 | 0.542 % | No |
| Homme id | 2 | 0.542 % | No |
| httpswwwlcwaikikimaenkidshappydreamspyjamas name | 2 | 0.542 % | No |
| httpswwwlcwaikikimaenkidsjeansweatshirt name | 2 | 0.542 % | No |
| Je suis | 2 | 0.542 % | No |
Four Phrase Analysis
| Words | Occurrences | Density | Possible Spam |
|---|---|---|---|
| name creative position 1 | 9 | 2.439 % | No |
| creative position 1 id | 3 | 0.813 % | No |
| id name creative position | 2 | 0.542 % | No |
| id httpswwwlcwaikikimaenkidsjeansweatshirt name creative | 2 | 0.542 % | No |
| Homme id name creative | 2 | 0.542 % | No |
| Femme Homme id name | 2 | 0.542 % | No |
| httpswwwlcwaikikimaencwomentunics name creative position | 2 | 0.542 % | No |
| id httpswwwlcwaikikimaencwomentunics name creative | 2 | 0.542 % | No |
| position 1 id httpswwwlcwaikikimaenkidsjeansweatshirt | 1 | 0.271 % | No |
| 1 id httpswwwlcwaikikimaenkidsjeansweatshirt name | 1 | 0.271 % | No |
| HEUREUX Je dors Je | 1 | 0.271 % | No |
| creative position 1 SWEATSHIRT | 1 | 0.271 % | No |
| grandis Je suis heureux | 1 | 0.271 % | No |
| suis heureux Découvrir id | 1 | 0.271 % | No |
| position 1 SWEATSHIRT JEANS | 1 | 0.271 % | No |
| dors Je grandis Je | 1 | 0.271 % | No |
| Je dors Je grandis | 1 | 0.271 % | No |
| Je grandis Je suis | 1 | 0.271 % | No |
| Je suis heureux Découvrir | 1 | 0.271 % | No |
| Faites des Combinaisons Quotidiennes | 1 | 0.271 % | No |
Websites Hosted on Same IP (i.e. 52.29.73.247)
Occasion Outlet - Kadın, Erkek Çocuk İndirimli Giyim Ürünleri
Eren Holding güvencesi altında Lacoste, Gant, Nautica ve diğer birçok markanın outlet ürünleri, ücretsiz kargo fırsatları ve 3 taksit avantajı ile online alışveriş sitesi...
97,387 
$ 155,520.00
Vakko
Stil sahibi, dinamik ve şık koleksiyonları ile Türkiye'de modanın en büyük söz sahibi Vakko, sizleri moda birikimini benzersiz lüks deneyimine dönüştürmeye davet ediyor.
132,002 $ 94,800.00
Size En Yakın M&S Online Türkiye | Marks & Spencer
Marks & Spencer sezonun öne çıkan parçaları ve birbirinden farklı ürün seçenekleri ile sizlerle. Kadın Giyim, Erkek Giyim, Çocuk Giyim, İç giyim, Dekorasyon ve Kozmetik...
171,250 $ 73,200.00
Küçük Ev Aletleri ve Elektrikli Mutfak Aletleri | Tefal Türkiye
Tencereden tavaya, kahve makinesinden ütüye yüzlerce ürün, üstün hizmet kalitesi ve özel fırsatlar ile alışverişin güvenilir adresi Tefal.com.tr'de!
98,447 $ 154,080.00
LC Waikiki Egypt Online - ال سي وايكيكي مصر - LC Waikiki
LC Waikiki مصر هنا! تسوق الأن عبر موقع LC Waikiki أفضل الملابس بأسعار مناسبة وتمتع بخصومات و دفع عند الإستلام وإمكانية الإسترجاع مجانا
70,640 $ 214,560.00
HTTP Header Analysis
Status-Code: 200
Status: 200 OK
Date: Wed, 30 Oct 2019 12:37:39 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Server: nginx
Vary: Cookie, Accept-Language
x-xss-protection: 1; mode=block
Content-Language: fr-fr
x-content-type-options: nosniff
X-Frame-Options: SAMEDOMAIN, ALLOW-FROM HTTPS://LCW.SAAS.APPDYNAMICS.COM
Content-Encoding: gzip
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| eu.atakdomain.com | |
51.75.28.75 |  United Kingdom |
| tr.atakdomain.com | |
185.46.40.60 |  Turkey |
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| lcwaikiki.ma | A | 3564 |
IP: 52.29.73.247 |
| lcwaikiki.ma | A | 3564 |
IP: 18.194.119.5 |
| lcwaikiki.ma | NS | 3600 |
Target: eu.atakdomain.com |
| lcwaikiki.ma | NS | 3600 |
Target: tr.atakdomain.com |
| lcwaikiki.ma | SOA | 3600 |
MNAME: tr.atakdomain.com RNAME: hostmaster.atakdomain.com Serial: 2019061301 Refresh: 10800 Retry: 3600 Expire: 604800 |
| lcwaikiki.ma | TXT | 3600 |
TXT: gnej7uhasvpad7sb451jiec5ru |
Full WHOIS Lookup
% The objects are in
RPSL format.
%
% The RIPE Database is subject to Terms and
Conditions.
% See
http://www.ripe.net/db/support/db-terms-conditions.pdf
%
Note: this output has been filtered.
% To receive output for a
database update, use the "-B" flag.
%ERROR:101: no entries
found
%
% No entries found in source RIPE.
% This
query was served by the RIPE Database Query Service version 1.95.1
(HEREFORD)
Similarly Ranked Websites
Helping Student Athletes Get Recruited | SportsRecruits
Your competitive advantage in the college recruiting process. Increase exposure in recruiting camps and tournaments. Post profiles and video to highlight your skills. Message...
121,827 $ 102,600.00
Online Virtual Piano Keyboard | Learn How to Play Piano
Pianu is the first interactive online piano that teaches you how to play. Learn how to read music and chords, all while playing your favorite songs. Online
121,832 $ 102,600.00
STS Tutorial | Downloads, Reviews, Tutorials & More
Welcome to STS Tutorial, your source for Free Tech Reviews, Downloads & Tutorials!
121,833 $ 102,600.00